PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010552881.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 221aa    MW: 25460.4 Da    PI: 6.9035
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010552881.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.86.1e-1498142347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+ E++l++ + k++G+g+W++I+r +  +Rt+ q+ s+ qky
   XP_010552881.1  98 PWTENEHKLFLIGLKKYGKGDWRSISRNVVVTRTPTQVASHAQKY 142
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.969151IPR017877Myb-like domain
SMARTSM007171.9E-5253IPR001005SANT/Myb domain
SuperFamilySSF466899.44E-11458IPR009057Homeodomain-like
CDDcd001679.69E-5651No hitNo description
PROSITE profilePS5129420.0591147IPR017930Myb domain
SuperFamilySSF466892.08E-1692148IPR009057Homeodomain-like
TIGRFAMsTIGR015576.8E-1794146IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.4E-1195141IPR009057Homeodomain-like
SMARTSM007178.7E-1095145IPR001005SANT/Myb domain
PfamPF002499.3E-1298142IPR001005SANT/Myb domain
CDDcd001674.73E-898143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MAANQWTRTE DKMFEESLVI FPETLPDRWE RIAEKLRKSP AEVREHYEAL VHDVSEIDSG  60
RVEMPDYVDD SAASWDSAPA QISFRAKHGD TEKKKGTPWT ENEHKLFLIG LKKYGKGDWR  120
SISRNVVVTR TPTQVASHAQ KYFLRQTSMK KERKRSSIHD ITITTVDNNN NNNMVAAMSG  180
PEWTWSAQPE SAQEQSPLPQ LPQSDFHGQA QFPRDQSFRF P
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010552881.11e-166PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H73e-56DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D3AZR11e-99A0A0D3AZR1_BRAOL; Uncharacterized protein
STRINGscaffold_600421.13e-98(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM51272750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.19e-90MYB family protein